PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_17734A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family Nin-like
Protein Properties Length: 257aa    MW: 28087.6 Da    PI: 9.2546
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_17734AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK72.65e-231561450
                     RWP-RK  4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkik 50
                               ++s e++sk Fslpi++AA+ Lgvc++vLKriCR +GI RWP+Rk+ 
  Oropetium_20150105_17734A 15 SLSYEEISKLFSLPIAEAASILGVCTSVLKRICRSHGIVRWPYRKLV 61
                               6899*****************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.665183IPR003035RWP-RK domain
PfamPF020423.8E-211661IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MASNAPAQPK PTRVSLSYEE ISKLFSLPIA EAASILGVCT SVLKRICRSH GIVRWPYRKL  60
VSGKAGDDPK NSEREKANKE LLEFSKAAKQ KPFSSSGPSA IHTDSAALAK DVSHESATHD  120
ASKGLTDDEL DWGADEGEGE ADGIVTRAEP SAQLCSLRRK AVDDGRKLLN GGARRGQQEF  180
SRLNKRQKVV LAQVFGASLP EEFVSSFAFS RASSALLHWR ERDRKIRFCT LRRADFWNRE  240
DVVDSEAAAA VAKFLD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010230688.12e-84PREDICTED: uncharacterized protein LOC104582530
TrEMBLA0A0Q3ICD53e-84A0A0Q3ICD5_BRADI; Uncharacterized protein
TrEMBLI1HDU52e-84I1HDU5_BRADI; Uncharacterized protein
STRINGBRADI2G08600.16e-84(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP67053242
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74480.13e-10RWP-RK domain-containing protein